PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g005954m
Common NameCISIN_1g005954mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRAS
Protein Properties Length: 668aa    MW: 73968.3 Da    PI: 6.1519
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g005954mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS417.71e-1272856511373
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                        lv+lL++c+ea+ s++  ++++++a+l + asp+g+p+ Rl+ay+teALa r++r +++++++ pp++ + +  +++ aal+l+++++Pi+k
  orange1.1g005954m 285 LVRLLTDCVEAIGSRNIPAVNHFIAKLGDVASPRGSPISRLTAYYTEALALRVSRLWPHTFHITPPRDFD-RVDDDSGAALRLLNQATPIPK 375
                        6899*****************************************************************8.5678888999*********** PP

               GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvak 184
                        f h+taN+++l+a++g++rvHiiDfdi+qGlQWp+++q+LasRp++p ++RiTg+g+    sk+el+etg+rL+ fAe+l++pfef++ v++
  orange1.1g005954m 376 FIHFTANEMLLRAFDGKDRVHIIDFDIKQGLQWPSFFQSLASRPNPPSHVRITGIGE----SKQELNETGDRLSGFAEALNLPFEFHP-VVD 462
                        *********************************************************....***************************.7** PP

               GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklp 276
                        rled++l++L+vk++E++aVn+++qlh++l +        +++L l++s++P++v ++eqea+hns+ + +r++++l+yysalfd ++ +lp
  orange1.1g005954m 463 RLEDVRLWMLHVKEKESVAVNCIFQLHKTLYSGNGG--VLRDFLGLIRSTNPTIVLMAEQEAEHNSPFLETRVSNSLRYYSALFDLIDYSLP 552
                        ******************************544433..3589************************************************** PP

               GRAS 277 reseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee...sgslvlgWkdr 365
                         +s  rik+E++ ++re++++vaceg++r erhe++e+Wr+++e+ GF+ + +se+++ q ++ll++++   y v+++    ++l+l W d+
  orange1.1g005954m 553 LDSPVRIKIEEM-FAREVRSIVACEGSDRLERHESFENWRRMMEQGGFRCMGISEREMLQSQMLLKMYSCGNYGVKKQgqdGAALTLSWIDQ 643
                        ************.********************************************************55588885444266677****** PP

               GRAS 366 pLvsvSaW 373
                        pL++vSaW
  orange1.1g005954m 644 PLYTVSAW 651
                        ******** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.028259629IPR005202Transcription factor GRAS
PfamPF035143.5E-125285651IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 668 aa     Download sequence    Send to blast
MLAGCSSSTL LSPRHRLRSE ASAQFPACHF QLPSMGTQRL DLPCSFSRKD SSRSQPIRPV  60
GLSVEKPIEP KTSACSLKQN VRLPPLATST QREIKDEFWE KGKSLKRFAE GGLVDESCIN  120
RAKRKKGSSG DNDGKNDDIH EGGGDSLSLG QLGTGNFWFQ PSFTGQNVPQ VPFTLTCSGE  180
KDRVCYVPGE FISPPLPLSN NPWVESVITE ITDLGEKDGD ETSHRLAKEV SASSTSSESG  240
SLALRLHENP VEHDVGNGSR NPYPHQGGVE ASEEGTNQGE NGFELVRLLT DCVEAIGSRN  300
IPAVNHFIAK LGDVASPRGS PISRLTAYYT EALALRVSRL WPHTFHITPP RDFDRVDDDS  360
GAALRLLNQA TPIPKFIHFT ANEMLLRAFD GKDRVHIIDF DIKQGLQWPS FFQSLASRPN  420
PPSHVRITGI GESKQELNET GDRLSGFAEA LNLPFEFHPV VDRLEDVRLW MLHVKEKESV  480
AVNCIFQLHK TLYSGNGGVL RDFLGLIRST NPTIVLMAEQ EAEHNSPFLE TRVSNSLRYY  540
SALFDLIDYS LPLDSPVRIK IEEMFAREVR SIVACEGSDR LERHESFENW RRMMEQGGFR  600
CMGISEREML QSQMLLKMYS CGNYGVKKQG QDGAALTLSW IDQPLYTVSA WAPVDVAGGS  660
SSFSQPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-5030865126374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006477403.10.0PREDICTED: scarecrow-like protein 28
SwissprotQ9CAN30.0SCL28_ARATH; Scarecrow-like protein 28
TrEMBLA0A067F8390.0A0A067F839_CITSI; Uncharacterized protein
STRINGPOPTR_0001s08850.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM72962743
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.10.0GRAS family protein